PDK1/PDPK1 Kinase Assay Service

Activity-based PDK1/PDPK1 kinase assay for compound screening and profiling via radiometric HotSpotTM kinase assay.
Target Overview
CAT#

PDK1/PDPK1

Enzyme

Human PDK1/PDPK1

HGNC

PDPK1

Synonym

PDK1

Substrates

Peptide substrate, [KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC], 20 µM
ATP 10 µM

Assay Properties
Reaction

Substrate + [γ-33P]-ATP = 33P-Substrate + ADP

Readout

Enzymatic activity

Reference Compound IC50s
Compounds IC50 (nM)
Staurosporine 0.7
Ro 31-8220 330
GW 5074 6,000
H-89 >100,000
Rottlerin >100,000
Scientific Information

O15530 (http://www.uniprot.org/uniprot/O15530)

Screening Location

Malvern, USA

Further information

More information can be found on our website Kinase Assays.

Reference compound IC50 for PDK1/PDPK1

Reference compound IC50 for PDK1/PDPK1